New products

Active filters
New Mots-c Mots-c

Reference: MOTSC10

Mots-c

(0)
MOTS-c is a specialised mitochondrial-derived peptide (MDP) developed for advanced scientific exploration of metabolic regulation, mitochondrial signalling, and cellular stress-response pathways, commonly studied in models of insulin sensitivity, energy homeostasis, and adaptive metabolism. Batch tested Purity: ≥ 99% (HPLC) CAS Number: 1627580-64-6...
£16.99
More Mots-c
In Stock
New LL-37 LL-37

Reference: LL37

LL-37

(0)
LL-37 is a synthetic cathelicidin-derived antimicrobial peptide used as a research tool to investigate host-defence peptide signalling and innate immune mechanisms in experimental systems. Batch tested Purity: ≥ 99% (HPLC) CAS Number: 154947-66-7 Molecular Formula: C205H340N60O53 Amino Acid Sequence: [LL-37, 37 aa] (37-residue...
£23.95
More LL-37
In Stock
New Livagen Livagen

Reference: LIVAGEN20

Livagen

(0)
Livagen is a synthetic tetrapeptide (Lys-Glu-Asp-Ala) used as a research tool to investigate peptide-mediated regulation of gene expression and chromatin accessibility in cell-culture systems. Batch tested Purity: ≥ 99% (HPLC) CAS Number: N/A Molecular Formula: C18H31N5O9 Amino Acid Sequence: Lys-Glu-Asp-Ala (KEDA) The products offered on this website...
£36.90
More Livagen
In Stock
New KPV KPV

Reference: KPV10

KPV

(0)
KPV is a tripeptide studied for its anti-inflammatory and immune-modulating properties. Used in vitro, it offers research potential in inflammation regulation, gut health, and skin regeneration, making it a valuable tool for immunology studies. Molecular Formula: C₁₆H₃₀N₄O₄ Molecular Weight: 384.48 g/mol Purity: 99% Sequence: Lys-Pro-Val The products...
£19.90
More KPV
In Stock
New Klow Blend Klow Blend

Reference: KLOW80

Klow Blend

(0)
Klow Blend Peptides is a research-grade peptide blend containing four components: GHK-Cu 50mg, BPC-157 10mg, TB-500 10mg and KPV 10mg. Together they’re formulated to support cellular repair, tissue regeneration and anti-inflammatory pathways in controlled laboratory settings. The products offered on this website are furnished for in-vitro studies only....
£49.00
More Klow Blend
In Stock
New Kisspeptin-10 Kisspeptin-10

Reference: KISS10

Kisspeptin-10

(0)
Kisspeptin-10, a neuropeptide regulating GnRH release, is central to reproductive function research. Studied for roles in fertility, puberty onset, and sexual health, it also provides insights into hormone therapy, reproductive medicine, and the metabolic–reproductive link in experimental models. Molecular Formula: C₁₀H₁₆N₆O₄ Molecular Weight:28 g/mol...
£24.90
More Kisspeptin-10
In Stock
New Ipamorelin Ipamorelin

Reference: IPA10

Ipamorelin

(0)
Ipamorelin is a synthetic pentapeptide used in laboratory research for studying growth hormone release. It selectively stimulates ghrelin receptors, supporting investigations into endocrine regulation, metabolism, muscle growth, and tissue repair mechanisms. Molecular Formula: C₃₈H₄₉N₉O₅ Molecular Weight: ~711.86 g/mol Purity: 99% The products offered...
£18.90
More Ipamorelin
In Stock
New Illumineuro Blend Illumineuro Blend

Reference: ILLUM46

Illumineuro Blend

(0)
Illumineuro is a specialized peptide blend combining Na Selank (6mg), Na Semax (20mg), PE-22-28 (10mg), and Pinealon (10mg). It is researched for cognitive enhancement, neuroprotection, mood regulation, and potential applications in neurological and memory-related studies. The products offered on this website are furnished for in-vitro studies only....
£99.00
More Illumineuro Blend
In Stock
New IGF-1 LR3 IGF-1 LR3

Reference: IGF1LR3

IGF-1 LR3

(0)
IGF-1 LR3, a long-acting insulin-like growth factor analog, supports muscle growth, tissue repair, and metabolic regulation. Widely studied in experimental models, it shows potential for skeletal muscle hypertrophy, cognitive function, regenerative medicine, and sports performance research. Molecular Formula: C₁₆H₂₆N₄O₈ Molecular Weight:39 g/mol Purity:...
£34.99
More IGF-1 LR3
In Stock
New Glutathione Glutathione

Reference: GLUT1500

Glutathione

(0)
Glutathione is a naturally occurring tripeptide developed for experimental investigation of cellular redox regulation, antioxidant defence mechanisms, and thiol-dependent biochemical signalling pathways. Purity: Conforms to internal specification CAS Number: 70-18-8 Compound Type: Naturally occurring tripeptide Amino Acid Sequence: γ-Glu-Cys-Gly (γ-ECG)
£29.99
More Glutathione
In Stock
New Glow Blend Glow Blend

Reference: GLOW

Glow Blend

(0)
Glow blend contains 3 ingredients: GHC-Cu 50mg, BPC-157 10mg and TB-500 10mg. Glow peptide is a synthetic research peptide studied for its potential roles in cell regeneration and tissue repair. In laboratory settings, it aids scientific exploration of wound healing, skin vitality, and regenerative mechanisms. The products offered on this website are...
£34.99
More Glow Blend
In Stock
New GHRP-6 GHRP-6

Reference: GHRP6

GHRP-6

(0)
GHRP-6 is a specialised research peptide developed for advanced scientific exploration of receptor-mediated signalling and neuroendocrine regulation within growth hormone secretagogue pathways. Batch tested Purity: ≥ 98.5 % (HPLC, typical) CAS Number: 87616-84-0 Molecular Formula: C₄₆H₅₆N₁₂O₆ Amino Acid Sequence: His-D-Trp-Ala-Trp-D-Phe-Lys-NH2...
£9.99
More GHRP-6
In Stock
Back to top

Follow us on Facebook

Facebook