Active filters
New Snap-8 Snap-8

Reference: SNAP10

Snap-8

(0)
SNAP-8 is an acetylated octapeptide developed for experimental investigation of SNARE-complex–mediated neurotransmitter release and peptide–receptor signalling pathways associated with neuromuscular transmission. Batch tested Purity: ≥ 99% (HPLC / SEC, typical) CAS Number: 868844-74-0 Amino Acid Sequence: Ac-Glu-Glu-Met-Gln-Arg-Arg-Ala-Asp-NH2...
£16.49
More Snap-8
In Stock
New SS-31 SS-31

Reference: SS31-10

SS-31

(0)
SS-31 is a mitochondria-targeting tetrapeptide developed for experimental investigation of mitochondrial function, oxidative stress modulation, and cardiolipin-associated signalling pathways within cellular bioenergetics research. Batch tested purity: ≥ 99% (HPLC, typical) CAS Number: 736992-21-5 Peptide Type: Synthetic mitochondria-targeting...
£19.90
More SS-31
In Stock
New TB-500 TB-500

Reference: TB500

TB-500

(0)
TB-500 is a synthetic N-acetylated heptapeptide (Ac-LKKTETQ) corresponding to residues 17-23 of thymosin β4, used experimentally to investigate actin dynamics, cell migration, and repair-associated signalling pathways in controlled laboratory systems. Batch tested Purity: ≥ 99% (HPLC) Molecular Formula: C38H68N10O14 Amino Acid Sequence: Ac-LKKTETQ...
£18.90
More TB-500
In Stock
New Teriparatide Teriparatide

Reference: TERI750

Teriparatide

(0)
Teriparatide, a bioactive parathyroid hormone fragment, is used in bone metabolism research. It stimulates osteoblast activity, promotes bone formation, enhances bone density, and supports studies on osteoporosis treatment and fracture healing mechanisms in experimental models.   Molecular Formula: C₁₁H₁₈N₄O₁₄ Molecular Weight:29 g/mol Purity: ≥99% The...
£34.90
More Teriparatide
In Stock
New Tesa / Ipamorelin Blend Tesa / Ipamorelin Blend

Reference: TESAIPA55

Tesa / Ipamorelin Blend

(0)
This Tesamorelin and Ipamorelin combination is designed for research on growth hormone modulation. Tesamorelin targets GHRH receptors, Ipamorelin stimulates ghrelin receptors, synergistically enhancing GH levels to support fat loss, muscle preservation, cognitive function, and metabolic or aging studies. The products offered on this website are furnished...
£22.90
More Tesa / Ipamorelin Blend
In Stock
New Tesamorelin Tesamorelin

Reference: TESA10

Tesamorelin

(0)
Tesamorelin is a synthetic growth hormone–releasing hormone (GHRH) analogue developed for experimental investigation of pituitary receptor–mediated signalling, growth hormone regulation, and downstream endocrine pathways. Batch tested Purity: ≥ 99% (HPLC) CAS Number: 901758-09-6 Molecular Formula: C221H366N72O67S Amino Acid Sequence:...
£24.90
More Tesamorelin
In Stock
New Testagen Testagen

Reference: TESTAGEN

Testagen

(0)
Testagen is a synthetic tetrapeptide used as a research tool to investigate tissue-specific gene-expression regulation in reproductive-tissue experimental systems. Batch tested Purity: ≥ 99% (HPLC) CAS Number: N/A Molecular Formula: C17H29N5O9 Amino Acid Sequence: Lys-Glu-Asp-Gly (KEDG) The products offered on this website are furnished for in-vitro...
£37.90
More Testagen
In Stock
New Thymogen Thymogen

Reference: THYMOGEN

Thymogen

(0)
Thymogen is a research peptide studied for its potential to support immune balance and tissue repair. Research suggests it may aid in cell regeneration, wound healing, and anti-aging processes, offering valuable insights into immune health and recovery. Molecular Formula: C₁₂H₂₄N₆O₄ Molecular Weight: 316.36 g/mol Purity: ≥99% Sequence: Glu-Trp The...
£37.50
More Thymogen
In Stock
New Thymosin Alpha 1 Thymosin Alpha 1

Reference: TA1

Thymosin Alpha 1

(0)
Thymosin Alpha-1 is a synthetic immunomodulatory peptide developed for experimental investigation of T-cell signalling, immune system regulation, and peptide-mediated cellular communication pathways. Batch tested Purity: ≥ 99% (HPLC) CAS Number: 62304-98-7 Molecular Formula: C129H215N33O55 Amino Acid Sequence: Ac-SDAAVDTSSEITTKDLKEKKEVVEEAEN (28-mer,...
£24.90
More Thymosin Alpha 1
In Stock
New Vesugen Vesugen

Reference: VESUGEN

Vesugen

(0)
Vesugen is a synthetic tripeptide used as a research tool to investigate tissue-specific gene-expression regulation in vascular / endothelial experimental systems. Batch tested Purity: ≥ 99% (HPLC) CAS Number: N/A Molecular Formula: C15H26N4O8 Amino Acid Sequence: Lys-Glu-Asp (KED) The products offered on this website are furnished for in-vitro studies...
£34.90
More Vesugen
In Stock
New Vilon Vilon

Reference: VILON

Vilon

(0)
Vilon is a synthetic dipeptide used as a research tool to investigate chromatin-level regulation of gene expression in immune-cell experimental systems. Batch tested Purity: ≥ 99% (HPLC) CAS Number: 45234-02-4 Molecular Formula: C11H21N3O5 Amino Acid Sequence: Lys-Glu (KE) The products offered on this website are furnished for in-vitro studies only....
£27.90
More Vilon
In Stock
New VIP VIP

Reference: VIP

VIP

(0)
VIP is a neuropeptide developed for experimental investigation of neuroendocrine signalling, smooth muscle regulation, and immune-modulatory pathways mediated via VPAC1 and VPAC2 receptors. Batch tested Purity: ≥ 99% (HPLC) CAS Number: 40077-57-4 Peptide Type: Synthetic vasoactive intestinal peptide Amino Acid Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2...
£27.90
More VIP
In Stock
Back to top

Follow us on Facebook

Facebook