• New
Thymogen
  • Thymogen
  • Thymogen

Thymogen

THYMOGEN

Thymogen is a research peptide studied for its potential to support immune balance and tissue repair. Research suggests it may aid in cell regeneration, wound healing, and anti-aging processes, offering valuable insights into immune health and recovery.

  • Molecular Formula: C₁₂H₂₄N₆O₄
  • Molecular Weight: 316.36 g/mol
  • Purity: ≥99%
  • Sequence: Glu-Trp

The products offered on this website are furnished for in-vitro studies only. In-vitro studies are performed outside of the body. These products are not medicines or drugs and have not been approved to prevent, treat or cure any medical condition, ailment or disease. Bodily introduction of any kind into humans or animals is strictly forbidden. 

Strength
£37.50
VAT included
Delivered within 1 - 3 days
Quantity
In Stock
1000 Items

  Cut off Times

Order before 15:00 for same day dispatch

  Delivery policy

Royal Mail Tracked 24

  Return policy

Moneyback guarantee

Description

Thymogen is a research peptide studied for its potential to support immune balance and tissue repair. Research suggests it may aid in cell regeneration, wound healing, and anti-aging processes, offering valuable insights into immune health and recovery.

  • Molecular Formula: C₁₂H₂₄N₆O₄
  • Molecular Weight: 316.36 g/mol
  • Purity: ≥99%
  • Sequence: Glu-Trp

The products offered on this website are furnished for in-vitro studies only. In-vitro studies are performed outside of the body. These products are not medicines or drugs and have not been approved to prevent, treat or cure any medical condition, ailment or disease. Bodily introduction of any kind into humans or animals is strictly forbidden. 

Product Details
THYMOGEN
1000 Items
Comments (0)
Grade
No customer reviews for the moment.
4 other products in the same category:
New LL-37 LL-37

Reference: LL37

LL-37

(0)
LL-37 is a synthetic cathelicidin-derived antimicrobial peptide used as a research tool to investigate host-defence peptide signalling and innate immune mechanisms in experimental systems. Batch tested Purity: ≥ 99% (HPLC) CAS Number: 154947-66-7 Molecular Formula: C205H340N60O53 Amino Acid Sequence: [LL-37, 37 aa] (37-residue...
£23.95
More LL-37
In Stock
New Sermorelin Sermorelin

Reference: SERM5

Sermorelin

(0)
Sermorelin is a peptide analogue of growth hormone–releasing hormone (GHRH 1–29), used in experimental research to investigate hypothalamic–pituitary signalling, growth hormone secretion dynamics, and receptor-mediated neuroendocrine regulation. Batch tested Purity: ≥ 99% (HPLC) CAS Number: 86168-78-7 Peptide Type: Synthetic GHRH (1–29) analogue peptide...
£14.95
More Sermorelin
In Stock
New Tesa / Ipamorelin Blend Tesa / Ipamorelin Blend

Reference: TESAIPA55

Tesa / Ipamorelin Blend

(0)
This Tesamorelin and Ipamorelin combination is designed for research on growth hormone modulation. Tesamorelin targets GHRH receptors, Ipamorelin stimulates ghrelin receptors, synergistically enhancing GH levels to support fat loss, muscle preservation, cognitive function, and metabolic or aging studies. The products offered on this website are furnished...
£22.90
More Tesa / Ipamorelin Blend
In Stock
New PNC-27 PNC-27

Reference: PNC30

PNC-27

(0)
PNC-27 is a p53-derived peptide designed for experimental investigation of p53-associated signalling and peptide–membrane interaction mechanisms. Batch tested Purity: ≥ 99% (HPLC) CAS Number: 1159861-00-3 Peptide Type: Synthetic p53-derived amphipathic peptide The products offered on this website are furnished for in-vitro studies only. In-vitro studies...
£49.00
More PNC-27
In Stock

Follow us on Facebook

Facebook